ProTx-I - 0.1 mg

>98% (HPLC)

NaV, CaV3.1, KV2.1, TRPA1 channels

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS.

ProTx-I (#STP-400) is a highly pure, synthetic, and biologically active peptide toxin.

3988 Da

ProTx-I inhibits voltage-gated Ca2+ (CaV3.1), K+ (KV2.1), and all Na+ channels tested (NaV1.2, NaV1.5, NaV1.7 and NaV1.8). The toxin shifts the voltage-dependence of channel activation to more positive potentials.

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

10-100 nM.

Lyophilized

β-theraphotoxin-Tp1a, Beta-theraphotoxin-Tp1a, Protoxin-I, ProTx-1, Protoxin-1, ProTx I

Disulfide bonds between Cys2-Cys16, Cys9-Cys21, Cys15-Cys28.

C171H245N53O47S6.

484598-35-8

Up to two weeks at 4°C or three months at -20°C.