Rabbit Polyclonal ANO6 Antibody

Unconjugated

Affinity purified

Rabbit

Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE. The peptide sequence for this immunogen was taken from within the described region.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Immunogen affinity purified

0.5 mg/ml

0.09% Sodium Azide

Polyclonal

ANO6

Western Blot 1.0 ug/ml

MuSpecies Glossary