Ceratotoxin-2 - 0.1 mg

>98% (HPLC)

NaV channels

DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL.

Ceratotoxin-2 (#STC-100) is a highly pure, synthetic, and biologically active peptide toxin.

4093 Da

Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

5 nM - 2 µM.

Lyophilized

β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2

Disulfide bonds between Cys2-Cys17, Cys9-Cys22, Cys16-Cys29. Leu33 - C-terminal amidation.

C177H260N52O49S6.

Up to two weeks at 4°C or three months at -20°C.