











>95% by SDS-PAGE
>95% by SDS-PAGE

Protein sequence(P37840 Met1-Ala140, with C-10*His)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGGGGSHHHHHHHHHH


>95% by SDS-PAGE







2μg (R: reducing conditions)
"}]
Alpha-synuclein is a neuronal protein that regulates synaptic vesicle trafficking and subsequent neurotransmitter release. It is abundant in the brain, while smaller amounts are found in the heart, muscle and other tissues. In the brain, alpha-synuclein is found mainly in the axon terminals of presynaptic neurons. Within these terminals, alpha-synuclein interacts with phospholipids and proteins. It plays a role in restricting the mobility of synaptic vesicles, consequently attenuating synaptic vesicle recycling and neurotransmitter release.


- 12 months from date of receipt, -20 to -70 °C as supplied.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
- 1 week, 2 to 8 °C under sterile conditions after reconstitution.
- Please avoid repeated freeze-thaw cycles.
参考图片
2μg (R: reducing conditions)
Immobilized Human Alpha-synuclein, His tag at 2 μg/mL (50 μL/well) can bind α-Synuclein Recombinant Rabbit mAb (S-441-86) (S0B0344) with EC50 of 13.11-21.33 ng/ml.