human BDNF-Biotin

Sulfo-NHS-LC-Biotin (~556 Da) was used for labeling human BDNF. The extent of labeling is 1-2 molecules of biotin per one molecule of human BDNF. The biotin is covalently conjugated to the N-terminus or to lysine residues present in human BDNF.

>98%

Modified recombinant protein

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.

human BDNF-Biotin (#B-250-B) is a highly pure, recombinant, and biologically active conjugated protein.

~28 kDa

BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2.

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

ED50 = 220 pM.

Lyophilized

Up to two weeks at 4°C or three months at -20°C.