Rabbit Polyclonal NXT1 Antibody

Unconjugated

Affinity purified

Rabbit

Synthetic peptide directed towards the N terminal of human NXT1The immunogen for this antibody is NXT1. Peptide sequence GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT. The peptide sequence for this immunogen was taken from within the described region.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Immunogen affinity purified

0.5 mg/ml

0.09% Sodium Azide

Polyclonal

NXT1

Western Blot 1.0 ug/ml

HuSpecies Glossary