PHLDA1 Recombinant Protein Antigen

>80% by SDS-PAGE and Coomassie blue staining

E. coli

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHLDA1. Source: E. coli Amino Acid Sequence: KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

No Preservative

PHLDA1

Antibody Competition 10 - 100 molar excess

HuSpecies Glossary