Rabbit Polyclonal SERCA2 ATPase Antibody

Unconjugated

Affinity purified

Rabbit

Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. The peptide sequence for this immunogen was taken from within the described region.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

115 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

0.5 mg/ml

0.09% Sodium Azide

Polyclonal

ATP2A2

Immunohistochemistry Immunohistochemistry-Paraffin Western Blot 1.0 ug/ml

Hu, Mu, PmSpecies Glossary