Rabbit Polyclonal Glucuronosyltransferase 1A1/UGT1A1 Antibody

Unconjugated

Protein A purified

Rabbit

Synthetic peptides corresponding to UGT1A1(UDP glucuronosyltransferase 1 family, polypeptide A1) The peptide sequence was selected from the middle region of UGT1A1 (NP_000454). Peptide sequence ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH. The peptide sequence for this immunogen was taken from within the described region.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

1 mg/ml

0.09% Sodium Azide

Polyclonal

UGT1A1

Western Blot 1.0 ug/ml

HuSpecies Glossary