Rabbit Polyclonal ZBED6 C-Terminal Like Antibody

Immunogen affinity purified

Rabbit

Synthetic peptides corresponding to C7ORF29 The peptide sequence was selected from the middle region of C7ORF29. Peptide sequence VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH. The peptide sequence for this immunogen was taken from within the described region.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

0.09% Sodium Azide

Polyclonal

C7ORF29

Western Blot 1.0 ug/ml